Structure of PDB 8ovj Chain f

Receptor sequence

>8ovjf (length=125) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

VKPTVSKAIVKKRTKRFTRHRYELFPQLSSSWRKPRGEDSPVRRRYKGQK
AMPNKGYGSDRATKYITPSGFRNFPINNVEDLYMLVMQNRKYAGVISHTV
GARKRKAIVRKAMELDVRLANGNAK

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	K3 V6 K12 K13 R17 F18 P27 Q28 L29 S32 W33 R34 K35 G38 E39 D40 P42 R44 R45 R46 K48 N55 K56 G57 Y58 S60 D61 R62 Y66 P69 S70 Y84 S98 H99 T100 G102 A103 R104 R106 K107 R111 K112	K2 V5 K11 K12 R16 F17 P26 Q27 L28 S31 W32 R33 K34 G37 E38 D39 P41 R43 R44 R45 K47 N54 K55 G56 Y57 S59 D60 R61 Y65 P68 S69 Y83 S97 H98 T99 G101 A102 R103 R105 K106 R110 K111

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links