Structure of PDB 8kab Chain f

Receptor sequence

>8kabf (length=37) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG

3D structure

• PDB: 8kab Cryo-EM structures reveal the molecular mechanism of HflX-mediated erythromycin resistance in mycobacteria.
• Chain: f
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	M1 K2 P5 S6 V7 K8 I10 V16 R19 H20 R31 K33 Q36 G37	M1 K2 P5 S6 V7 K8 I10 V16 R19 H20 R31 K33 Q36 G37

Gene Ontology

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8kab, PDBe:8kab, PDBj:8kab
• PDBsum: 8kab
• PubMed: 39029461
• UniProt: A0QSL4|RL36_MYCS2 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)