Structure of PDB 8iwh Chain f

Receptor sequence
>8iwhf (length=31) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence]
IFTFRWLAVHGLAIPTVFFLGGITAMQFIQR
3D structure
PDB8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII
Chainf
Resolution2.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM f R17 W18 H22 A25 R5 W6 H10 A13
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iwh, PDBe:8iwh, PDBj:8iwh
PDBsum8iwh
PubMed37878698
UniProtA0T0U1|PSBF_THAPS Cytochrome b559 subunit beta (Gene Name=psbF)

[Back to BioLiP]