Structure of PDB 8ir3 Chain f

Receptor sequence
>8ir3f (length=258) Species: 9606 (Homo sapiens) [Search protein sequence]
VERPFYDLWASDNPLDRPLVGQDEFFLEQTKKKGVKRPARLHTKPSQAPA
VEVAPAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLALPATEQA
ATQESTFQELCEGLEKKTEQQRRREKAVHRLRVQQAALRAARLRHQELFR
LRGIKAQVALRLAELARRQRRRQARREAEADKPRRLGRLKYQAPDIDVQL
SSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEK
RAFREIQL
3D structure
PDB8ir3 Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Chainf
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f V222 R471 V35 R251
BS02 rna f R277 Q278 E335 K336 K337 R342 R343 L385 R388 R391 R392 R396 E397 R404 R405 R454 E455 R456 A457 K458 F459 K462 K464 R90 Q91 E115 K116 K117 R122 R123 L165 R168 R171 R172 R176 E177 R184 R185 R234 E235 R236 A237 K238 F239 K242 K244
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0042802 identical protein binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001932 regulation of protein phosphorylation
GO:0006281 DNA repair
GO:0006364 rRNA processing
GO:0006974 DNA damage response
GO:0007095 mitotic G2 DNA damage checkpoint signaling
GO:0031333 negative regulation of protein-containing complex assembly
GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0039535 regulation of RIG-I signaling pathway
GO:0042254 ribosome biogenesis
GO:0042981 regulation of apoptotic process
GO:0050821 protein stabilization
GO:0051726 regulation of cell cycle
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0071456 cellular response to hypoxia
GO:1901796 regulation of signal transduction by p53 class mediator
GO:1901797 negative regulation of signal transduction by p53 class mediator
GO:1901837 negative regulation of transcription of nucleolar large rRNA by RNA polymerase I
GO:1902570 protein localization to nucleolus
GO:1903006 positive regulation of protein K63-linked deubiquitination
GO:1903715 regulation of aerobic respiration
GO:1990173 protein localization to nucleoplasm
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005829 cytosol
GO:0033553 rDNA heterochromatin
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ir3, PDBe:8ir3, PDBj:8ir3
PDBsum8ir3
PubMed37491604
UniProtQ9NZM5|NOP53_HUMAN Ribosome biogenesis protein NOP53 (Gene Name=NOP53)

[Back to BioLiP]