Structure of PDB 8ekc Chain f |
>8ekcf (length=103) Species: 562 (Escherichia coli) [Search protein sequence] |
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS PMV |
|
PDB | 8ekc Insights into the molecular mechanism of translation inhibition by the ribosome-targeting antibiotic thermorubin. |
Chain | f |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
f |
R86 V89 R91 |
R86 V89 R91 |
|
|
|
|