Structure of PDB 8e5t Chain f

Receptor sequence
>8e5tf (length=88) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
SHRLYVKGKHLSYQRNPNVSLIKIEGVATPQDAQFYLGKRIAYVIRVMWG
KVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI
3D structure
PDB8e5t A co-transcriptional ribosome assembly checkpoint controls nascent large ribosomal subunit maturation.
Chainf
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f S15 Q17 R18 L29 L45 R65 K70 R73 H75 G76 N77 S78 R82 R86 N106 S12 Q14 R15 L21 L37 R46 K51 R54 H56 G57 N58 S59 R63 R67 N87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8e5t, PDBe:8e5t, PDBj:8e5t
PDBsum8e5t
PubMed37037974
UniProtP05744|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)

[Back to BioLiP]