Structure of PDB 8cvm Chain f

Receptor sequence

>8cvmf (length=203) Species: 1747 (Cutibacterium acnes) [Search protein sequence]

AHEMPRLKKQYREQIRAAMQEEFGYRNPMLIPGLEKIVVNMGVGDAAHDS
KVMDGAIRDITAITGQKPQVTKARKSIAQFKLREGQPIGCHVTLRGDRMW
EFADRLLTLALPRIRDFRGLNSNQFDGKGNYTFGLSEQVMFLEIDQDKID
RIRGMDITFVTTAQTNEEGKALLKHLGFPFKAKDDPKKAKTKRGPAYYAK
KKK

3D structure

PDB

8cvm Sarecycline inhibits protein translation in Cutibacterium acnes 70S ribosome using a two-site mechanism.

Chain

Resolution

2.66 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	f	K42 V44 N46 M47 G48 G50 T77 A79 R80 K81 Q85 F86 I94 H97 Q130 F131 D132 K134 T138 F139 G140 G160 M161 D162 K206 K207	K36 V38 N40 M41 G42 G44 T71 A73 R74 K75 Q79 F80 I88 H91 Q124 F125 D126 K128 T132 F133 G134 G154 M155 D156 K200 K201
BS02	rna	f	N33 P34 M35 Q72 K73 Q75 V98 T99 R101	N27 P28 M29 Q66 K67 Q69 V92 T93 R95
BS03	rna	f	I83 A84 R89	I77 A78 R83

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cvm, PDBe:8cvm, PDBj:8cvm
PDBsum	8cvm
PubMed	36864821
UniProt	Q6A6N8\|RL5_CUTAK Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]