Structure of PDB 8byq Chain f

Receptor sequence
>8byqf (length=82) Species: 8355 (Xenopus laevis) [Search protein sequence]
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAV
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB8byq Structural basis of transcription reduction by a promoter-proximal +1 nucleosome.
Chainf
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna f R36 R46 I47 S48 G49 R79 K80 T81 R15 R25 I26 S27 G28 R58 K59 T60
BS02 dna f T31 P33 R37 T10 P12 R16
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8byq, PDBe:8byq, PDBj:8byq
PDBsum8byq
PubMed37148879
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]