Structure of PDB 8asl Chain f

Receptor sequence
>8aslf (length=142) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
DDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYP
HLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEV
VINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
3D structure
PDB8asl The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Chainf
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA f G105 Y108 G82 Y85
BS02 CLA f S91 F94 G102 S68 F71 G79
BS03 CLA f V77 F87 V54 F64
BS04 CLA f Y108 L109 E122 I125 I131 M134 Y85 L86 E99 I102 I108 M111
BS05 CLA f I97 W100 I101 M134 I74 W77 I78 M111
BS06 CLA f D78 G79 R80 D55 G56 R57
BS07 ZEX f V77 G79 G99 G102 W140 V54 G56 G76 G79 W117
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8asl, PDBe:8asl, PDBj:8asl
PDBsum8asl
PubMed37542031
UniProtP29256|PSAF_SYNY3 Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]