Structure of PDB 7ymi Chain f

Receptor sequence
>7ymif (length=30) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence]
IYTVRWLAVHTLGVPLVWFLGAIASMQFIN
3D structure
PDB7ymi Structure of a large photosystem II supercomplex from Acaryochloris marina.
Chainf
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8CT f L32 L36 L16 L20
BS02 HEM f R21 W22 V25 H26 R5 W6 V9 H10
Gene Ontology
Molecular Function
GO:0020037 heme binding
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ymi, PDBe:7ymi, PDBj:7ymi
PDBsum7ymi
PubMed38394197
UniProtB0C2V2

[Back to BioLiP]