Structure of PDB 7xam Chain f

Receptor sequence

>7xamf (length=37) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG

3D structure

• PDB: 7xam Cryo-EM structures reveal a unique conformational dynamics of the Mycobacterium 23S rRNA helices
• Chain: f
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	M1 K2 P5 S6 V7 K8 R19 H20 R22 P30 R31 K33 Q36 G37	M1 K2 P5 S6 V7 K8 R19 H20 R22 P30 R31 K33 Q36 G37
BS02	ZN	f	C27 H32	C27 H32

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7xam, PDBe:7xam, PDBj:7xam
• PDBsum: 7xam
• PubMed: 37709237
• UniProt: A0QSL4|RL36_MYCS2 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)