Structure of PDB 7uph Chain f

Receptor sequence

>7uphf (length=117) Species: 562 (Escherichia coli)

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

• PDB: 7uph Three-dimensional structure-guided evolution of a ribosome with tethered subunits.
• Chain: f
• Resolution: 4.18 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	H10 S14 N16 N17 T21 T23 Q26 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 P103 I104 P105 H106 N107 G108 C109 R110 R115 R116 V117	H10 S14 N16 N17 T21 T23 Q26 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 P103 I104 P105 H106 N107 G108 C109 R110 R115 R116 V117

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uph, PDBe:7uph, PDBj:7uph
• PDBsum: 7uph
• PubMed: 35836020
• UniProt: P0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)