Structure of PDB 7umh Chain f

Receptor sequence
>7umhf (length=141) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
DFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPH
LIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQEVV
INVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
3D structure
PDB7umh Energetic robustness to large scale structural fluctuations in a photosynthetic supercomplex.
Chainf
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA f G80 G83 G78 G81
BS02 CLA f Y86 E100 M112 Y84 E98 M110
BS03 CLA f S69 F72 A76 G77 S67 F70 A74 G75
BS04 CLA f V55 F65 S69 V53 F63 S67
BS05 CLA f I75 W78 I79 V82 M112 I73 W76 I77 V80 M110
BS06 CLA f D56 G57 R58 F59 D54 G55 R56 F57
BS07 CLA f I67 L71 I65 L69
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7umh, PDBe:7umh, PDBj:7umh
PDBsum7umh
PubMed37532717
UniProtP29256|PSAF_SYNY3 Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]