Structure of PDB 7uif Chain f |
>7uiff (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
MNVTPLDELQWKSPEWIQVFGLRTENVLDYFAESPFFDKTSNNQVIKMQR QFSQLNPARRQILFKYPMYMQLEEELMKLDGTEYVLSSVREPDFWVIRKQ RRTNNSGVGSAKGPEIIPLQDYYIIGANIYQTIFKIVQSRLMSTSYHLNS TLESLYDLIEFQPSQGVHY |
|
PDB | 7uif Structural basis of a transcription pre-initiation complex on a divergent promoter. |
Chain | f |
Resolution | 4.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
f |
L9 Q10 W11 K12 |
L9 Q10 W11 K12 |
|
|
|
Biological Process |
GO:0006357 |
regulation of transcription by RNA polymerase II |
GO:0032968 |
positive regulation of transcription elongation by RNA polymerase II |
GO:0045944 |
positive regulation of transcription by RNA polymerase II |
GO:0051123 |
RNA polymerase II preinitiation complex assembly |
GO:0060261 |
positive regulation of transcription initiation by RNA polymerase II |
|
|