Structure of PDB 7rf8 Chain f

Receptor sequence

>7rf8f (length=34) Species: 197221 (Thermosynechococcus vestitus BP-1)

SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

3D structure

• PDB: 7rf8 Structural dynamics in the water and proton channels of photosystem II during the S 2 to S 3 transition.
• Chain: f
• Resolution: 2.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	f	I15 R19 W20 V23 H24 A27	I4 R8 W9 V12 H13 A16

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:7rf8, PDBe:7rf8, PDBj:7rf8
• PDBsum: 7rf8
• PubMed: 34764256
• UniProt: Q8DIN9|PSBF_THEVB Cytochrome b559 subunit beta (Gene Name=psbF)