Structure of PDB 7pic Chain f

Receptor sequence
>7picf (length=145) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKVILKQDVSNLGKRFDVVDVKDGYAIHFLFPKKLAAPLTKKSLQDRDLF
LKKQQEHYEINKALSHKLKEVIEQTELHFSLKEHNGRPYGSIITKQIINQ
AHTKGMALQKFMFKDNVRLGFGDHEITLHIFEDTTAVLKVKVTPD
3D structure
PDB7pic Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainf
Resolution9.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f Y25 A26 I27 L30 F31 P38 T40 K41 E83 H84 N85 T94 K95 N99 H102 T103 K110 F111 K114 N116 Y25 A26 I27 L30 F31 P38 T40 K41 E83 H84 N85 T94 K95 N99 H102 T103 K110 F111 K114 N116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pic, PDBe:7pic, PDBj:7pic
PDBsum7pic
PubMed36171285
UniProtP75540|RL9_MYCPN Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]