Structure of PDB 7pia Chain f

Receptor sequence
>7piaf (length=145) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MKVILKQDVSNLGKRFDVVDVKDGYAIHFLFPKKLAAPLTKKSLQDRDLF
LKKQQEHYEINKALSHKLKEVIEQTELHFSLKEHNGRPYGSIITKQIINQ
AHTKGMALQKFMFKDNVRLGFGDHEITLHIFEDTTAVLKVKVTPD
3D structure
PDB7pia Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainf
Resolution13.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f L12 D23 Y25 I27 L30 F31 P38 L39 T40 K41 L49 F50 K53 I93 K95 N99 H102 T103 M106 A107 K110 F111 N116 V117 L12 D23 Y25 I27 L30 F31 P38 L39 T40 K41 L49 F50 K53 I93 K95 N99 H102 T103 M106 A107 K110 F111 N116 V117
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pia, PDBe:7pia, PDBj:7pia
PDBsum7pia
PubMed36171285
UniProtP75540|RL9_MYCPN Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]