Structure of PDB 7of1 Chain f

Receptor sequence

>7of1f (length=106) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

3D structure

PDB

7of1 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	A2 E3 S4 H5 R6 Y8 K10 Q17 R18 S19 K20 R21 V22 N23 P25 Q42 L45 G46 R48 Y53 R54 S56 K57 R60 I64 R65 V66 W68 K70 T72 R73 H75 G76 N77 S78 R82 R86 N87 N88 L89 P90 A91 K92 F94 A96 S97 R99 N106	A1 E2 S3 H4 R5 Y7 K9 Q16 R17 S18 K19 R20 V21 N22 P24 Q41 L44 G45 R47 Y52 R53 S55 K56 R59 I63 R64 V65 W67 K69 T71 R72 H74 G75 N76 S77 R81 R85 N86 N87 L88 P89 A90 K91 F93 A95 S96 R98 N105

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7of1, PDBe:7of1, PDBj:7of1
PDBsum	7of1
PubMed	34813592
UniProt	P05744\|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)

[Back to BioLiP]