Structure of PDB 7ar8 Chain f |
>7ar8f (length=98) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
MNTDITALEKAQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYL SGIKPGIKGPSMVTGGLIGLMGGFMYAYQNSAGRLMGFFPNDGEVASY |
|
PDB | 7ar8 A ferredoxin bridge connects the two arms of plant mitochondrial complex I. |
Chain | f |
Resolution | 3.53 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
T7X |
f |
L50 I53 |
L50 I53 |
|
|
|
|