Structure of PDB 6zpo Chain f

Receptor sequence
>6zpof (length=83) Species: 9913 (Bos taurus) [Search protein sequence]
PLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKG
SIAGLSMVLAAYVFLNYCRSYKELKHERLRKYH
3D structure
PDB6zpo Structure of the dimeric ATP synthase from bovine mitochondria.
Chainf
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CDL f G54 S55 I56 L63 G50 S51 I52 L59
BS02 CDL f L12 G40 Y41 R43 Y44 K47 Y48 M61 F68 L8 G36 Y37 R39 Y40 K43 Y44 M57 F64
BS03 CDL f Q38 Y41 Y42 L69 Q34 Y37 Y38 L65
Gene Ontology
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0042776 proton motive force-driven mitochondrial ATP synthesis
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zpo, PDBe:6zpo, PDBj:6zpo
PDBsum6zpo
PubMed32900941
UniProtQ28851|ATPK_BOVIN ATP synthase subunit f, mitochondrial (Gene Name=ATP5MF)

[Back to BioLiP]