Structure of PDB 6zmr Chain f

Receptor sequence

>6zmrf (length=83) Species: 9823 (Sus scrofa) [Search protein sequence]

PLKDRRLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKG
SVAGLSMVLAAYVVFNYCRSYKELKHERLRKYH

3D structure

PDB

6zmr Structure of the dimeric ATP synthase from bovine mitochondria.

Chain

Resolution

3.94 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CDL	f	K53 G54 S55 S60	K49 G50 S51 S56

Gene Ontology

	Molecular Function
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism

	Biological Process
GO:0006754	ATP biosynthetic process
GO:0042776	proton motive force-driven mitochondrial ATP synthesis
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0045259	proton-transporting ATP synthase complex
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)

External links

PDB	RCSB:6zmr, PDBe:6zmr, PDBj:6zmr
PDBsum	6zmr
PubMed	32900941
UniProt	Q95339\|ATPK_PIG ATP synthase subunit f, mitochondrial (Gene Name=ATP5MF)