Structure of PDB 6v3a Chain f

Receptor sequence
>6v3af (length=94) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYP
INKIHKAHYILMNVECGQSTLDELEELFRYNDAIIRNLIIRREH
3D structure
PDB6v3a Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
Chainf
Resolution2.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f R2 Y4 R86 I89 I90 R91 R2 Y4 R86 I89 I90 R91
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v3a, PDBe:6v3a, PDBj:6v3a
PDBsum6v3a
PubMed31964740
UniProtB7IBC1|RS6_ACIB5 Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]