Structure of PDB 6tnn Chain f

Receptor sequence
>6tnnf (length=138) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEFGIQALEASWITNRQIEAA
RIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPG
KVLFEISGVSEEVAREALRLASHKLPIKTKFVKREEIG
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chainf
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f P4 R6 K8 H13 R14 R18 K22 G23 G24 H28 W41 R45 Q46 R56 W65 R82 M83 G84 S85 G86 K87 H123 K124 P4 R6 K8 H13 R14 R18 K22 G23 G24 H28 W41 R45 Q46 R56 W65 R82 M83 G84 S85 G86 K87 H123 K124
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP14577|RL16_BACSU Large ribosomal subunit protein uL16 (Gene Name=rplP)

[Back to BioLiP]