Structure of PDB 6n8n Chain f

Receptor sequence

>6n8nf (length=170) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

HFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVK
KASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAA
VETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPL
PHRVQKSTKTFSYKRPSTFY

3D structure

PDB

6n8n Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	N65 E66 H68 P69 K71 R84 S85 H88 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 Y139 L144 K146 H154 R155 K161 Y165 S169 T170 F171	N63 E64 H66 P67 K69 R82 S83 H86 M88 Y89 K90 Q106 A109 A110 R111 H112 R113 R115 T130 Y137 L142 K144 H152 R153 K159 Y163 S167 T168 F169
BS02	rna	f	S39 Y43 Q46 H49 K50 K52 R117 R119	S37 Y41 Q44 H47 K48 K50 R115 R117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6n8n, PDBe:6n8n, PDBj:6n8n
PDBsum	6n8n
PubMed	30814529
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]