Structure of PDB 6gqv Chain f

Receptor sequence

>6gqvf (length=106) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AESHRLYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAY
VYRASKEVRGSKIRVMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
LYPSNI

3D structure

PDB

6gqv Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	A2 E3 S4 H5 R6 Y8 K10 Q17 R18 S19 K20 R21 P25 Y53 R54 S56 K57 R60 S62 I64 R65 V66 M67 W68 K70 H75 G76 N77 S78 R86 N87 N88 L89 P90 A91 K92 F94 G95 S97 N106	A1 E2 S3 H4 R5 Y7 K9 Q16 R17 S18 K19 R20 P24 Y52 R53 S55 K56 R59 S61 I63 R64 V65 M66 W67 K69 H74 G75 N76 S77 R85 N86 N87 L88 P89 A90 K91 F93 G94 S96 N105

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6gqv, PDBe:6gqv, PDBj:6gqv
PDBsum	6gqv
PubMed	29886014
UniProt	P05744\|RL33A_YEAST Large ribosomal subunit protein eL33A (Gene Name=RPL33A)