Structure of PDB 5oy0 Chain f

Receptor sequence
>5oy0f (length=143) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGY
PHLIVDGRFTHAGDFLIPSILFLYIAGWIGWVGRSYLIEIRESKNPEMQE
VVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
3D structure
PDB5oy0 Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.
Chainf
Resolution2.501 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA f Y86 E100 I103 M112 Y86 E100 I103 M112
BS02 CLA f G80 G83 Y86 G80 G83 Y86
BS03 CLA f A122 V123 A122 V123
BS04 CLA f F65 S69 F72 L73 A76 F65 S69 F72 L73 A76
BS05 CLA f I75 W78 I79 V82 M112 I75 W78 I79 V82 M112
BS06 CLA f D56 G57 R58 F59 D56 G57 R58 F59
BS07 ZEX f F65 P68 F65 P68
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oy0, PDBe:5oy0, PDBj:5oy0
PDBsum5oy0
PubMed29414678
UniProtP29256|PSAF_SYNY3 Photosystem I reaction center subunit III (Gene Name=psaF)

[Back to BioLiP]