Structure of PDB 5lzu Chain f

Receptor sequence

>5lzuf (length=109) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

SGRLWCKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVY
KAKNNTVTPGGKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRI
RVMLYPSRI

3D structure

PDB

5lzu Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.

Chain

Resolution

3.75 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	S2 G3 R4 L5 W6 K8 K15 R16 G17 L18 R19 Q21 R22 E23 H24 K29 Y34 V50 Y51 K52 K54 N55 N56 T57 V58 T59 P60 R68 V69 W71 K73 R76 H78 G79 N80 S81 R85 K87 R89 S90 N91 P93 A94 K95 H99 R100 R102 R109	S1 G2 R3 L4 W5 K7 K14 R15 G16 L17 R18 Q20 R21 E22 H23 K28 Y33 V49 Y50 K51 K53 N54 N55 T56 V57 T58 P59 R67 V68 W70 K72 R75 H77 G78 N79 S80 R84 K86 R88 S89 N90 P92 A93 K94 H98 R99 R101 R108

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5lzu, PDBe:5lzu, PDBj:5lzu
PDBsum	5lzu
PubMed	27863242
UniProt	G1SF08\|RL35A_RABIT Large ribosomal subunit protein eL33 (Gene Name=RPL35A)