Structure of PDB 5lj3 Chain f |
>5lj3f (length=72) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVA GVSHGTLGEIFIRCNNVLYIRE |
|
PDB | 5lj3 Cryo-EM structure of the spliceosome immediately after branching. |
Chain | f |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
f |
Y48 R74 |
Y37 R63 |
|
|
|
|