Structure of PDB 5it7 Chain f

Receptor sequence
>5it7f (length=69) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLA
NHGDRFYCGKCHSTFATQK
3D structure
PDB5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
Chainf
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f K82 T86 P88 K89 I91 R92 K94 K97 K99 L100 A101 V102 A131 R136 Y138 G140 K1 T5 P7 K8 I10 R11 K13 K16 K18 L19 A20 V21 A50 R55 Y57 G59
BS02 ZN f T145 F146 T64 F65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5it7, PDBe:5it7, PDBj:5it7
PDBsum5it7
PubMed27159451
UniProtP69061|RS27A_KLULA Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=ubi3)

[Back to BioLiP]