Structure of PDB 5gth Chain f

Receptor sequence

>5gthf (length=31) Species: 32053 (Thermostichus vulcanus)

IFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

3D structure

• PDB: 5gth Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
• Chain: f
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	f	R19 W20 V23 H24 A27	R5 W6 V9 H10 A13

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:5gth, PDBe:5gth, PDBj:5gth
• PDBsum: 5gth
• PubMed: 28219079
• UniProt: P12239|PSBF_THEVL Cytochrome b559 subunit beta (Gene Name=psbF)