Structure of PDB 5dgf Chain f

Receptor sequence
>5dgff (length=148) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHL
VAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDT
KDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD
3D structure
PDB5dgf Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
Chainf
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f V42 T49 G50 K51 H52 G53 H54 K56 H58 I62 K69 L73 S76 H78 V33 T40 G41 K42 H43 G44 H45 K47 H49 I53 K60 L64 S67 H69
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0003746 translation elongation factor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
Biological Process
GO:0002182 cytoplasmic translational elongation
GO:0002184 cytoplasmic translational termination
GO:0006412 translation
GO:0006413 translational initiation
GO:0006414 translational elongation
GO:0006452 translational frameshifting
GO:0045901 positive regulation of translational elongation
GO:0045905 positive regulation of translational termination
GO:0045948 positive regulation of translational initiation
GO:0072344 rescue of stalled ribosome
GO:0097622 cytoplasmic translational elongation through polyproline stretches
GO:0140708 CAT tailing
GO:1903272 positive regulation of cytoplasmic translational elongation through polyproline stretches
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5dgf, PDBe:5dgf, PDBj:5dgf
PDBsum5dgf
PubMed
UniProtP23301|IF5A1_YEAST Eukaryotic translation initiation factor 5A-1 (Gene Name=HYP2)

[Back to BioLiP]