Structure of PDB 4d61 Chain f

Receptor sequence
>4d61f (length=61) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
NKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHY
CGKCCLTYCFN
3D structure
PDB4d61 Cryo-Em of Ribosomal 80S Complexes with Termination Factors Reveals the Translocated Cricket Paralysis Virus Ires.
Chainf
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f N91 K94 R95 K97 K99 V102 Y105 R118 V130 F131 A133 S134 H135 R138 Y140 G142 K143 T147 N1 K4 R5 K7 K9 V12 Y15 R28 V40 F41 A43 S44 H45 R48 Y50 G52 K53 T57
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d61, PDBe:4d61, PDBj:4d61
PDBsum4d61
PubMed25601755
UniProtG1SK22|RS27A_RABIT Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS27A)

[Back to BioLiP]