Structure of PDB 3jcj Chain f

Receptor sequence

>3jcjf (length=509) Species: 562 (Escherichia coli)

DTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVASGEAGGITQHIGAY
HVETENGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGVMPQTIE
AIQHAKAAQVPVVVAVNKIDKPEADPDRVKNELSQYGILPEEWGGESQFV
HVSAKAGTGIDELLDAILLQAEVLELKAVRKGMASGAVIESFLDKGRGPV
ATVLVREGTLHKGDIVLCGFEYGRVRAMRNELGQEVLEAGPSIPVEILGL
SGVPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANM
TEGEVHEVNIVLKADVQGSVEAISDSLLKLSTDEVKVKIIGSGVGGITET
DATLAAASNAILVGFNVRADASARKVIEAESLDLRYYSVIYNLIDEVKAA
MSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGVVKRHNPIRVL
RDNVVIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRTGDVIEVFE
IIEIQRTIA

3D structure

• PDB: 3jcj Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
• Chain: f
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	f	H399 P477 Y772 D776 R824 H825 N853 R856 N857	H18 P96 Y391 D395 R443 H444 N472 R475 N476
BS02	rna	f	L574 K576 G577 G579 P580 R605 R607 A608 R651 T729 S753	L193 K195 G196 G198 P199 R224 R226 A227 R270 T348 S372
BS03	rna	f	F809 I812 S844 R846 R847 F848 I863	F428 I431 S463 R465 R466 F467 I482
BS04	GNP	f	V400 D401 G403 K404 T405 S406 P446 G447 K499 S534 A535 K536	V19 D20 G22 K23 T24 S25 P65 G66 K118 S153 A154 K155
BS05	FME	f	F848 E860	F467 E479

Gene Ontology

Molecular Function

• GO:0003743 translation initiation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0043024 ribosomal small subunit binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0009409 response to cold
• GO:0061077 chaperone-mediated protein folding

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:3jcj, PDBe:3jcj, PDBj:3jcj
• PDBsum: 3jcj
• PubMed: 26973877
• UniProt: P0A705|IF2_ECOLI Translation initiation factor IF-2 (Gene Name=infB)