Structure of PDB 3jam Chain f

Receptor sequence
>3jamf (length=69) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLA
NHGDRFYCGKCHSTFATQK
3D structure
PDB3jam Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
Chainf
Resolution3.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f K82 K83 T87 P88 K89 I91 R92 H93 K94 H95 K97 K99 V102 Y105 R118 I128 F129 A131 N132 H133 R136 Y138 C139 G140 K141 H143 S144 K1 K2 T6 P7 K8 I10 R11 H12 K13 H14 K16 K18 V21 Y24 R37 I47 F48 A50 N51 H52 R55 Y57 C58 G59 K60 H62 S63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jam, PDBe:3jam, PDBj:3jam
PDBsum3jam
PubMed26212456
UniProtP69061|RS27A_KLULA Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=ubi3)

[Back to BioLiP]