Structure of PDB 3j81 Chain f

Receptor sequence
>3j81f (length=69) Species: 28985 (Kluyveromyces lactis) [Search protein sequence]
KKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLA
NHGDRFYCGKCHSTFATQK
3D structure
PDB3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
Chainf
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna f K82 P88 K89 I91 R92 K94 H95 K97 K99 L100 A101 Y105 R118 F129 A131 N132 H133 R136 Y138 G140 H143 K1 P7 K8 I10 R11 K13 H14 K16 K18 L19 A20 Y24 R37 F48 A50 N51 H52 R55 Y57 G59 H62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j81, PDBe:3j81, PDBj:3j81
PDBsum3j81
PubMed25417110
UniProtP69061|RS27A_KLULA Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=ubi3)

[Back to BioLiP]