Structure of PDB 7y7a Chain ee

Receptor sequence

>7y7aee (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7y7a In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	ee	N72 C73 R77 R78 A81 C82 D85 L120 V122	N72 C73 R77 R78 A81 C82 D85 L120 V122
BS02	PEB	ee	N35 K36 D39 N42 I142 T143 F153 A154 A155 G156 D157 C158	N35 K36 D39 N42 I142 T143 F153 A154 A155 G156 D157 C158
BS03	PEB	ee	C50 D54 C61 A136 Q137 F141 A146 T147 E148	C50 D54 C61 A136 Q137 F141 A146 T147 E148
BS04	PEB	ee	Y74 N76	Y74 N76

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y7a, PDBe:7y7a, PDBj:7y7a
PDBsum	7y7a
PubMed	36922595
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]