Structure of PDB 6woo Chain ee

Receptor sequence
>6wooee (length=53) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNP
GPS
3D structure
PDB6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
Chainee
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ee A9 R10 A11 K13 V14 K15 Q17 T18 V21 K23 E25 K26 P27 K28 P30 K31 R33 A34 K36 R37 T41 R43 V45 N46 M56 N57 A1 R2 A3 K5 V6 K7 Q9 T10 V13 K15 E17 K18 P19 K20 P22 K23 R25 A26 K28 R29 T33 R35 V37 N38 M48 N49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6woo, PDBe:6woo, PDBj:6woo
PDBsum6woo
PubMed
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]