Structure of PDB 7osa Chain eL43

Receptor sequence

>7osaeL43 (length=91) Species: 4932 (Saccharomyces cerevisiae)

AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA

3D structure

• PDB: 7osa Accuracy mechanism of eukaryotic ribosome translocation.
• Chain: eL43
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	eL43	A2 R4 T5 K6 K7 V8 G9 I10 G12 K13 Y14 G15 V16 R17 Y18 G19 S20 S21 R23 Q33 H34 C42 K44 R49 A51 K62 Y69	A1 R3 T4 K5 K6 V7 G8 I9 G11 K12 Y13 G14 V15 R16 Y17 G18 S19 S20 R22 Q32 H33 C41 K43 R48 A50 K61 Y68
BS02	rna	eL43	R24 R84	R23 R83
BS03	ZN	eL43	C39 C42 C57 C60	C38 C41 C56 C59

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0046872 metal ion binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7osa, PDBe:7osa, PDBj:7osa
• PDBsum: 7osa
• PubMed: 34853469
• UniProt: P0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)