Structure of PDB 7osm Chain eL40

Receptor sequence
>7osmeL40 (length=52) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB7osm Accuracy mechanism of eukaryotic ribosome translocation.
ChaineL40
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna eL40 K93 R97 Y100 R102 P104 N109 R111 K112 R113 K114 G116 N119 R122 K124 K125 K17 R21 Y24 R26 P28 N33 R35 K36 R37 K38 G40 N43 R46 K48 K49
BS02 ZN eL40 C96 C99 C110 C115 C20 C23 C34 C39
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sun Dec 1 05:31:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7osm', asym_id = 'eL40', title = 'Accuracy mechanism of eukaryotic ribosome translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7osm', asym_id='eL40', title='Accuracy mechanism of eukaryotic ribosome translocation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7osm', asym_id = 'eL40'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7osm', asym_id='eL40')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>