Structure of PDB 7osm Chain eL37

Receptor sequence

>7osmeL37 (length=84) Species: 4932 (Saccharomyces cerevisiae)

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASK

3D structure

• PDB: 7osm Accuracy mechanism of eukaryotic ribosome translocation.
• Chain: eL37
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	eL37	G2 K3 T5 P6 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 H28 Q30 K32 S35 K43 T44 R45 Y47 N48 W49 K52 R55 R56 T58 T59 K75	G1 K2 T4 P5 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 H27 Q29 K31 S34 K42 T43 R44 Y46 N47 W48 K51 R54 R55 T57 T58 K74
BS02	rna	eL37	R21 V29 A42 G60 T61 G62 R63 M64 Y66 L67 K68 V70 R72 F74 N76 Q79 T80 G81 S82 A83 K85	R20 V28 A41 G59 T60 G61 R62 M63 Y65 L66 K67 V69 R71 F73 N75 Q78 T79 G80 S81 A82 K84
BS03	ZN	eL37	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 23:28:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7osm', asym_id = 'eL37', title = 'Accuracy mechanism of eukaryotic ribosome translocation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7osm', asym_id='eL37', title='Accuracy mechanism of eukaryotic ribosome translocation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7osm', asym_id = 'eL37'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7osm', asym_id='eL37')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>