Structure of PDB 6tnu Chain eI

Receptor sequence

>6tnueI (length=154) Species: 4932 (Saccharomyces cerevisiae)

EEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHG
HAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLM
NMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEA
ARTD

3D structure

• PDB: 6tnu The Ccr4-Not complex monitors the translating ribosome for codon optimality.
• Chain: eI
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	eI	R27 X51 R87 K151	R24 X48 R84 K148
BS02	rna	eI	T49 X51 G53 H54 H58 K69 E71 L73 P75 H78	T46 X48 G50 H51 H55 K66 E68 L70 P72 H75

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003743 translation initiation factor activity
• GO:0003746 translation elongation factor activity
• GO:0005515 protein binding
• GO:0043022 ribosome binding

Biological Process

• GO:0002182 cytoplasmic translational elongation
• GO:0002184 cytoplasmic translational termination
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:0006414 translational elongation
• GO:0006452 translational frameshifting
• GO:0045901 positive regulation of translational elongation
• GO:0045905 positive regulation of translational termination
• GO:0045948 positive regulation of translational initiation
• GO:0072344 rescue of stalled ribosome
• GO:0097622 cytoplasmic translational elongation through polyproline stretches
• GO:0140708 CAT tailing
• GO:1903272 positive regulation of cytoplasmic translational elongation through polyproline stretches

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0048471 perinuclear region of cytoplasm

External links

• PDB: RCSB:6tnu, PDBe:6tnu, PDBj:6tnu
• PDBsum: 6tnu
• PubMed: 32299921
• UniProt: P23301|IF5A1_YEAST Eukaryotic translation initiation factor 5A-1 (Gene Name=HYP2)