Structure of PDB 6kgx Chain eD

Receptor sequence
>6kgxeD (length=248) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
AFSSIQNVLTDAPLGTPSAMGFLDERTEKPLMGPSEMDELVYAVYKQVFG
NAHIMESERAELRDAESLFRYLRDVREFVRALAKSNAYTSRFLQGNQQYR
FFELNFKHLLGRGPRSLEEMASHSALYAEGGFEAVIDAILDSDEYAQEFG
STVVPYCRFKGEYPTNEEFNRMLVLKGANSTSDKAGKGRSKLCYSIAAGC
SQNWLSMSKALPFGTEKGTGFNLISSSRNPAARPRIGTKIPGGVVFSS
3D structure
PDB6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
ChaineD
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB eD N106 A107 H108 S235 S237 K239 N51 A52 H53 S180 S182 K184
BS02 PEB eD S59 I60 G216 Y218 N221 F224 S4 I5 G161 Y163 N166 F169
BS03 PEB eD S122 R125 Y126 S67 R70 Y71
BS04 PEB eD Q153 Y154 A176 S179 Q98 Y99 A121 S124
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 19:05:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kgx', asym_id = 'eD', title = 'Structural basis of energy transfer in Porphyridium purpureum phycobilisome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kgx', asym_id='eD', title='Structural basis of energy transfer in Porphyridium purpureum phycobilisome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '6kgx', asym_id = 'eD'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='6kgx', asym_id='eD')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>