Structure of PDB 5y6p Chain eB

Receptor sequence

>5y6peB (length=177) Species: 35689 (Griffithsia pacifica)

MLDAFSRVVVNSDSKAAYVGGSDLQSLKTFISDGNKRLDAVNCIVSNASC
IVSDAISGMICENPGLIAPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DSSVLDDRCLNGLKETYIALGVPTASTSRAVSIMKAASTAFIMNTASGRK
IEIAAGDCQALQSEAAAYFDKVGSAVD

3D structure

• PDB: 5y6p Structure of phycobilisome from the red alga Griffithsia pacifica
• Chain: eB
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	eB	M59 N72 C73 R78 A81 C82 D85 Y117 P123	M59 N72 C73 R78 A81 C82 D85 Y117 P123
BS02	PEB	eB	K36 D39 A40 I153 A154 G156 C158	K36 D39 A40 I153 A154 G156 C158
BS03	PUB	eB	C50 D54 S57 G58 C61	C50 D54 S57 G58 C61

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 10:16:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5y6p', asym_id = 'eB', title = 'Structure of phycobilisome from the red alga Griffithsia pacifica'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5y6p', asym_id='eB', title='Structure of phycobilisome from the red alga Griffithsia pacifica')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '5y6p', asym_id = 'eB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='5y6p', asym_id='eB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>