Structure of PDB 8b2l Chain e3

Receptor sequence

>8b2le3 (length=131) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

AGNKFRMSLGLPVAATINCADNTGAKNLYIISVKGIKGRLNRLPSACVGD
MVMATVKKGKPDLRKKVMPAVVVRQRKPWRRKDGVFMYFEDNAGVIVNPK
GEMKGSAITGPIGKECADLWPRIASAANAIV

3D structure

PDB

8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e3	N31 R131	N22 R122
BS02	rna	e3	G11 N12 K13 F14 R15 S17 G19 P21 V22 A23 A24 T25 I40 S41 K43 G44 I45 K46 R48 L49 N50 R51 L52 P53 M62 T64 K66 K74 V76 R85 K86 F95 N101	G2 N3 K4 F5 R6 S8 G10 P12 V13 A14 A15 T16 I31 S32 K34 G35 I36 K37 R39 L40 N41 R42 L43 P44 M53 T55 K57 K65 V67 R76 K77 F86 N92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links