Structure of PDB 7piw Chain e1

Receptor sequence
>7piwe1 (length=76) Species: 3046 (Dunaliella salina) [Search protein sequence]
ERPFSDILTSIRYWVIHSITVPSLFIAGWLFVSTGLAYDVFGSPRPNEYF
TEDRQDAPLITDRFNALEQVKKLSAQ
3D structure
PDB7piw Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.
Chaine1
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide e1 T67 D68 E74 Q75 K78 T61 D62 E68 Q69 K72
BS02 HEM e1 I13 Y19 H23 T26 V27 I7 Y13 H17 T20 V21
BS03 4RF e1 P9 S11 P3 S5
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7piw, PDBe:7piw, PDBj:7piw
PDBsum7piw
PubMed36799903
UniProtD0FY01

[Back to BioLiP]