Structure of PDB 7oyb Chain e1

Receptor sequence

>7oybe1 (length=125) Species: 7955 (Danio rerio) [Search protein sequence]

LRPLTKPKIVKKRTKKFIRHQSDRYVKIRANWRKPRGIDNRVRRRFKGQM
LMPNIGYGSNRKTKHMLPSGFKKFLVHNVKELEVLMMSNKSHCAEIAHNV
SSKNRKLIVERAAQLAIKVTNPNAR

3D structure

PDB

7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	e1	R5 K14 K15 R16 T17 K18 K19 F20 R22 H23 Q24 D26 R27 Y28 V29 K30 I31 N34 W35 R36 K37 R39 G40 I41 D42 N43 R44 R46 R47 R48 F49 K50 G51 Q52 M53 P56 N57 I58 G59 Y60 G61 S62 N63 R64 K65 K67 H68 L70 P71 K76 H80 N81 E98 A100 H101 N102 V103 S104 S105 K106 N107 R108 N124 A127 R128	R2 K11 K12 R13 T14 K15 K16 F17 R19 H20 Q21 D23 R24 Y25 V26 K27 I28 N31 W32 R33 K34 R36 G37 I38 D39 N40 R41 R43 R44 R45 F46 K47 G48 Q49 M50 P53 N54 I55 G56 Y57 G58 S59 N60 R61 K62 K64 H65 L67 P68 K73 H77 N78 E95 A97 H98 N99 V100 S101 S102 K103 N104 R105 N121 A124 R125
BS02	MG	e1	S25 I31	S22 I28

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links