Structure of PDB 6hhq Chain e1

Receptor sequence
>6hhqe1 (length=51) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSVYKVN
A
3D structure
PDB6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
Chaine1
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e1 L103 R118 V130 F131 A133 N134 H135 R138 Y140 G142 K143 H145 S146 K149 L2 R17 V29 F30 A32 N33 H34 R37 Y39 G41 K42 H44 S45 K48
BS02 ZN e1 C126 C144 C25 C43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0031386 protein tag activity
GO:0031625 ubiquitin protein ligase binding
GO:0046872 metal ion binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002109 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, LSU-rRNA,5S)
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0016567 protein ubiquitination
GO:0019941 modification-dependent protein catabolic process
GO:0042254 ribosome biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
PDBsum6hhq
PubMed30759226
UniProtP05759|RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS31)

[Back to BioLiP]