Structure of PDB 5on6 Chain e1

Receptor sequence
>5on6e1 (length=51) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSVYKVN
A
3D structure
PDB5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.
Chaine1
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e1 L103 R118 V130 F131 A133 N134 H135 R138 Y140 G142 K143 H145 S146 K149 L2 R17 V29 F30 A32 N33 H34 R37 Y39 G41 K42 H44 S45 K48
BS02 ZN e1 C121 C144 C20 C43
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum5on6
PubMed29429877
UniProtP05759|RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein (Gene Name=RPS31)

[Back to BioLiP]