Structure of PDB 4yuu Chain e1

Receptor sequence
>4yuue1 (length=57) Species: 2771 (Cyanidium caldarium) [Search protein sequence]
IHSITIPSLFIAGWLFVSTGLAYDVFGTPRPNEYFSENRQQVPLINDRFN
AREELDD
3D structure
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Chaine1
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide e1 F31 G34 W35 V38 F10 G13 W14 V17
BS02 HEM e1 H23 I27 L30 H2 I6 L9
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtQ9TM20|PSBE_CYACA Cytochrome b559 subunit alpha (Gene Name=psbE)

[Back to BioLiP]