Structure of PDB 4u51 Chain e0

Receptor sequence
>4u51e0 (length=62) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVN
GKRRMNPGPSVQ
3D structure
PDB4u51 ?
Chaine0
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna e0 A2 V4 R10 A11 G12 K13 V14 K15 Q17 T18 K20 K23 T24 K26 K28 K31 R33 A34 K36 R37 R43 R55 N57 A1 V3 R9 A10 G11 K12 V13 K14 Q16 T17 K19 K22 T23 K25 K27 K30 R32 A33 K35 R36 R42 R54 N56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0010494 cytoplasmic stress granule
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u51, PDBe:4u51, PDBj:4u51
PDBsum4u51
PubMed25209664
UniProtP0CX33|RS30A_YEAST Small ribosomal subunit protein eS30A (Gene Name=RPS30A)

[Back to BioLiP]